Lineage for d4o4ha2 (4o4h A:246-439)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420939Protein automated matches [227071] (2 species)
    not a true protein
  7. 1420940Species Cow (Bos taurus) [TaxId:9913] [226565] (11 PDB entries)
  8. 1420957Domain d4o4ha2: 4o4h A:246-439 [237360]
    Other proteins in same PDB: d4o4ha1, d4o4hb1, d4o4hc1, d4o4hd1, d4o4he_
    automated match to d3rycc2
    complexed with acp, ca, gdp, gol, gtp, llm, mg

Details for d4o4ha2

PDB Entry: 4o4h (more details), 2.1 Å

PDB Description: Tubulin-Laulimalide complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o4ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4ha2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d4o4ha2:

Click to download the PDB-style file with coordinates for d4o4ha2.
(The format of our PDB-style files is described here.)

Timeline for d4o4ha2: