Class a: All alpha proteins [46456] (284 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (1 protein) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (21 PDB entries) |
Domain d4o4he_: 4o4h E: [237361] Other proteins in same PDB: d4o4ha1, d4o4ha2, d4o4hb1, d4o4hb2, d4o4hc1, d4o4hc2, d4o4hd1, d4o4hd2 automated match to d4i4te_ complexed with acp, ca, gdp, gol, gtp, llm, mg |
PDB Entry: 4o4h (more details), 2.1 Å
SCOPe Domain Sequences for d4o4he_:
Sequence, based on SEQRES records: (download)
>d4o4he_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d4o4he_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d4o4he_: