Lineage for d4mcka_ (4mck A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888916Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1888917Protein automated matches [190563] (12 species)
    not a true protein
  7. 1888931Species Maize (Zea mays) [TaxId:4577] [237294] (1 PDB entry)
  8. 1888932Domain d4mcka_: 4mck A: [237295]
    automated match to d3hbex_

Details for d4mcka_

PDB Entry: 4mck (more details), 1.5 Å

PDB Description: Crystal structure of Family GH19, Class IV chitinase from Zea mays
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d4mcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcka_ d.2.1.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
xxxxxvvsdaffngiknqagsgcegknfytrsaflsavnaypgfahggtevegkreiaaf
fahvthqtghfcyiseinksnaycdasnrwpcaagqkyygrgplqiswnynygpagrdig
fngladpnrvaqdaviafktalwfwmnnvhrlmpqgfgatirainglecngnnpaqmnar
vgyykqycqqlrvdpgpnltc

SCOPe Domain Coordinates for d4mcka_:

Click to download the PDB-style file with coordinates for d4mcka_.
(The format of our PDB-style files is described here.)

Timeline for d4mcka_: