Lineage for d1bgmk3 (1bgm K:3-219)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942205Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 942206Protein beta-Galactosidase [49804] (2 species)
  7. 942214Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 942297Domain d1bgmk3: 1bgm K:3-219 [23728]
    Other proteins in same PDB: d1bgmi1, d1bgmi2, d1bgmi4, d1bgmi5, d1bgmj1, d1bgmj2, d1bgmj4, d1bgmj5, d1bgmk1, d1bgmk2, d1bgmk4, d1bgmk5, d1bgml1, d1bgml2, d1bgml4, d1bgml5, d1bgmm1, d1bgmm2, d1bgmm4, d1bgmm5, d1bgmn1, d1bgmn2, d1bgmn4, d1bgmn5, d1bgmo1, d1bgmo2, d1bgmo4, d1bgmo5, d1bgmp1, d1bgmp2, d1bgmp4, d1bgmp5
    complexed with mg

Details for d1bgmk3

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)
PDB Compounds: (K:) beta-galactosidase

SCOPe Domain Sequences for d1bgmk3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmk3 b.18.1.5 (K:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1bgmk3:

Click to download the PDB-style file with coordinates for d1bgmk3.
(The format of our PDB-style files is described here.)

Timeline for d1bgmk3: