Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (20 species) not a true protein |
Species European sea anemone (Actinia equina) [TaxId:6106] [237221] (1 PDB entry) |
Domain d4ohsa_: 4ohs A: [237222] automated match to d2c9ia_ complexed with cl |
PDB Entry: 4ohs (more details), 2.19 Å
SCOPe Domain Sequences for d4ohsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohsa_ d.22.1.0 (A:) automated matches {European sea anemone (Actinia equina) [TaxId: 6106]} gaplvtedmcikmtmegtinghhfkcvgegegkpfegtqvekiriteggplpfaydilap ccmygmygsktfikhvsgipdyfkesfpegftwertqifedggsltihqdtslqgnnfif kvnviganfpangpvmqkktagwepsveilyprdgvlcgqalmalkctdgdhltshlrtt yrsrkpsnavnmpefhfgdhrieilkaeqgkfyeqyesavaryce
Timeline for d4ohsa_: