Lineage for d4l6za1 (4l6z A:176-321)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735148Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1735149Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1735174Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1735175Protein automated matches [226964] (1 species)
    not a true protein
  7. 1735176Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)
  8. 1735188Domain d4l6za1: 4l6z A:176-321 [237034]
    Other proteins in same PDB: d4l6za2
    automated match to d3c49a1
    complexed with 1dc, dms

Details for d4l6za1

PDB Entry: 4l6z (more details), 2 Å

PDB Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor STO1168
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4l6za1:

Sequence, based on SEQRES records: (download)

>d4l6za1 a.41.1.0 (A:176-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
qalqavseqektveevphpldrdyql

Sequence, based on observed residues (ATOM records): (download)

>d4l6za1 a.41.1.0 (A:176-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
leealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqal
qavseqektveevphpldrdyql

SCOPe Domain Coordinates for d4l6za1:

Click to download the PDB-style file with coordinates for d4l6za1.
(The format of our PDB-style files is described here.)

Timeline for d4l6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l6za2