Lineage for d4luda1 (4lud A:85-146)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536307Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 1536308Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)
  8. 1536344Domain d4luda1: 4lud A:85-146 [236787]
    Other proteins in same PDB: d4luda2, d4luda3, d4ludb2, d4ludb3
    automated match to d1qcfa1
    complexed with ca, cl, gol, sk8

Details for d4luda1

PDB Entry: 4lud (more details), 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luda1:

Sequence, based on SEQRES records: (download)

>d4luda1 b.34.2.1 (A:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Sequence, based on observed residues (ATOM records): (download)

>d4luda1 b.34.2.1 (A:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarlet

SCOPe Domain Coordinates for d4luda1:

Click to download the PDB-style file with coordinates for d4luda1.
(The format of our PDB-style files is described here.)

Timeline for d4luda1: