SCOPe 2.04: Domain d4luda2: 4lud A:147-249

Lineage for d4luda2 (4lud A:147-249)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (18 PDB entries)

8. Domain d4luda2: 4lud A:147-249 [236788]
   Other proteins in same PDB: d4luda1, d4luda3, d4ludb1, d4ludb3
   automated match to d1qcfa2
   complexed with ca, cl, gol, sk8

Details for d4luda2

PDB Entry: 4lud, 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luda2:

Sequence, based on SEQRES records:

>d4luda2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records):

>d4luda2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldgfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d4luda2:

• d4luda2 first appeared in SCOPe 2.03
  
• d4luda2 appears in SCOPe 2.05
  
• d4luda2 appears in the current release, SCOPe 2.08