Lineage for d4io0a1 (4io0 A:1-287)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509472Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries)
  8. 2509479Domain d4io0a1: 4io0 A:1-287 [236722]
    Other proteins in same PDB: d4io0a2
    automated match to d1cqwa_
    complexed with rn1, so4; mutant

Details for d4io0a1

PDB Entry: 4io0 (more details), 2.9 Å

PDB Description: Crystal structure of F128A mutant of an epoxide hydrolase from Bacillus megaterium complexed with its product (R)-3-[1]naphthyloxy-propane-1,2-diol
PDB Compounds: (A:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4io0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4io0a1 c.69.1.0 (A:1-287) automated matches {Bacillus megaterium [TaxId: 1404]}
mskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynl
sekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliaf
ngphpytamrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgylt
addvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdp
tfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

SCOPe Domain Coordinates for d4io0a1:

Click to download the PDB-style file with coordinates for d4io0a1.
(The format of our PDB-style files is described here.)

Timeline for d4io0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4io0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4io0b_