SCOPe 2.08: Domain d4io0a1: 4io0 A:1-287

Lineage for d4io0a1 (4io0 A:1-287)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries)

8. Domain d4io0a1: 4io0 A:1-287 [236722]
   Other proteins in same PDB: d4io0a2
   automated match to d1cqwa_
   complexed with rn1, so4; mutant

Details for d4io0a1

PDB Entry: 4io0, 2.9 Å

PDB Description: Crystal structure of F128A mutant of an epoxide hydrolase from Bacillus megaterium complexed with its product (R)-3-[1]naphthyloxy-propane-1,2-diol

PDB Compounds: (A:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4io0a1:

Sequence; same for both SEQRES and ATOM records:

>d4io0a1 c.69.1.0 (A:1-287) automated matches {Bacillus megaterium [TaxId: 1404]}
mskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynl
sekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliaf
ngphpytamrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgylt
addvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdp
tfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

Timeline for d4io0a1:

• d4io0a1 first appeared in SCOPe 2.03, called d4io0a_
  
• d4io0a1 appears in SCOPe 2.07