Lineage for d3wgwa2 (3wgw A:127-255)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431831Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1431832Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1432017Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1432039Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
  7. 1432069Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
    Uniprot P12004
  8. 1432117Domain d3wgwa2: 3wgw A:127-255 [236662]
    automated match to d1u7ba2
    protein/DNA complex; complexed with so4, t2b

Details for d3wgwa2

PDB Entry: 3wgw (more details), 2.8 Å

PDB Description: structure of pcna bound to a small molecule inhibitor
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3wgwa2:

Sequence, based on SEQRES records: (download)

>d3wgwa2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d3wgwa2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte
avtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyylap
ki

SCOPe Domain Coordinates for d3wgwa2:

Click to download the PDB-style file with coordinates for d3wgwa2.
(The format of our PDB-style files is described here.)

Timeline for d3wgwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgwa1