![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.0: automated matches [227244] (1 protein) not a true family |
![]() | Protein automated matches [227010] (5 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [236135] (6 PDB entries) |
![]() | Domain d4irra_: 4irr A: [236407] automated match to d4iqqa_ complexed with dtt, ump |
PDB Entry: 4irr (more details), 2.48 Å
SCOPe Domain Sequences for d4irra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irra_ d.117.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} qqvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvy wkgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwr hfgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcq fyvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysn hvdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkipmd
Timeline for d4irra_: