SCOPe 2.06: Domain d4irra_: 4irr A:

Lineage for d4irra_ (4irr A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.0: automated matches [227244] (1 protein)
   not a true family

6. Protein automated matches [227010] (5 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [236135] (6 PDB entries)

8. Domain d4irra_: 4irr A: [236407]
   automated match to d4iqqa_
   complexed with dtt, ump

Details for d4irra_

PDB Entry: 4irr, 2.48 Å

PDB Description: Crystal Structure of C.elegans Thymidylate Synthase in Complex with dUMP

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4irra_:

Sequence; same for both SEQRES and ATOM records:

>d4irra_ d.117.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qqvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvy
wkgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwr
hfgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcq
fyvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysn
hvdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkipmd

Timeline for d4irra_:

• d4irra_ first appeared in SCOPe 2.03
  
• d4irra_ appears in SCOPe 2.05
  
• d4irra_ appears in SCOPe 2.07
  
• d4irra_ appears in the current release, SCOPe 2.08