Class b: All beta proteins [48724] (177 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein Spherulin 3a (S3a) [49708] (1 species) |
Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries) |
Domain d1hdfa_: 1hdf A: [23627] complexed with ca |
PDB Entry: 1hdf (more details), 2.35 Å
SCOPe Domain Sequences for d1hdfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdfa_ b.11.1.1 (A:) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum) [TaxId: 5791]} svckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkafi fkddrfngnfirleessqvtdlttrnlndaissmivatfe
Timeline for d1hdfa_: