Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (40 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:76857] [236129] (1 PDB entry) |
Domain d4iedb_: 4ied B: [236131] automated match to d3fv7a_ complexed with cl, edo, mg, na |
PDB Entry: 4ied (more details), 1.5 Å
SCOPe Domain Sequences for d4iedb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iedb_ e.3.1.0 (B:) automated matches {Fusobacterium nucleatum [TaxId: 76857]} sfgnenqfmkeiferkglngtfvvydlkndkidyynldranerfypassfkifntligle ngivknvdemfyyydgskvfldswakdsnlryaikvsqvpaykklarelgkermqeglnk lnygnkeigseidkfwlegplkisameqvkllnllsqsklpfklenqeqvkditilekkd dfilhgktgwatdnivvpigwfvgwietsdniysfainldisdskflpkreeivreyfkn invik
Timeline for d4iedb_: