Lineage for d4l1fa1 (4l1f A:1-228)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621090Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2621091Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2621236Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2621237Protein automated matches [226934] (29 species)
    not a true protein
  7. 2621241Species Acidaminococcus fermentans [TaxId:591001] [236041] (1 PDB entry)
  8. 2621242Domain d4l1fa1: 4l1f A:1-228 [236042]
    Other proteins in same PDB: d4l1fa2, d4l1fb2
    automated match to d4o5md1
    complexed with cos, fad, na, pdo, po4

Details for d4l1fa1

PDB Entry: 4l1f (more details), 1.79 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation
PDB Compounds: (A:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d4l1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1fa1 e.6.1.0 (A:1-228) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgke

SCOPe Domain Coordinates for d4l1fa1:

Click to download the PDB-style file with coordinates for d4l1fa1.
(The format of our PDB-style files is described here.)

Timeline for d4l1fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l1fa2