SCOPe 2.03: Domain d4l1fa1: 4l1f A:1-228

Lineage for d4l1fa1 (4l1f A:1-228)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Acidaminococcus fermentans [TaxId:591001] [236041] (1 PDB entry)

8. Domain d4l1fa1: 4l1f A:1-228 [236042]
   Other proteins in same PDB: d4l1fa2, d4l1fb2
   automated match to d4o5md1
   complexed with cos, fad, na, pdo, po4

Details for d4l1fa1

PDB Entry: 4l1f, 1.79 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation

PDB Compounds: (A:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d4l1fa1:

Sequence; same for both SEQRES and ATOM records:

>d4l1fa1 e.6.1.0 (A:1-228) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgke

Timeline for d4l1fa1:

• d4l1fa1 is new in SCOPe 2.03-stable
  
• d4l1fa1 appears in SCOPe 2.04
  
• d4l1fa1 appears in the current release, SCOPe 2.08