| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
| Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
| Protein automated matches [190060] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries) |
| Domain d4c2be_: 4c2b E: [235985] Other proteins in same PDB: d4c2bb_, d4c2bd_, d4c2bf_, d4c2bh_ automated match to d4c29a_ complexed with mes, peg, so4; mutant |
PDB Entry: 4c2b (more details), 2.8 Å
SCOPe Domain Sequences for d4c2be_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2be_ c.62.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgsh
ayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllma
sqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdel
eqqrdeivsylcdlapeap
Timeline for d4c2be_: