Class b: All beta proteins [48724] (177 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein gamma-Crystallin [49697] (9 species) duplication consists of two domains of this fold |
Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries) |
Domain d4gcra2: 4gcr A:86-174 [23590] |
PDB Entry: 4gcr (more details), 1.47 Å
SCOPe Domain Sequences for d4gcra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gcra2 b.11.1.1 (A:86-174) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]} gtfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyl lrpgeyrryldwgamnakvgslrrvmdfy
Timeline for d4gcra2: