Lineage for d4mbzc_ (4mbz C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2087547Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2087548Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2087618Protein automated matches [191200] (7 species)
    not a true protein
  7. 2087636Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)
  8. 2087649Domain d4mbzc_: 4mbz C: [235583]
    automated match to d4mbxd_
    protein/DNA complex; complexed with ca, cl, edo, ipa

Details for d4mbzc_

PDB Entry: 4mbz (more details), 1.75 Å

PDB Description: structure of b-lymphotropic polyomavirus vp1 in complex with 3'- sialyllactosamine
PDB Compounds: (C:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbzc_ b.121.6.1 (C:) automated matches {Human polyomavirus 9 [TaxId: 943908]}
shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
adiagvhtnysetqvwrglpryfnvtlrkrivknp

SCOPe Domain Coordinates for d4mbzc_:

Click to download the PDB-style file with coordinates for d4mbzc_.
(The format of our PDB-style files is described here.)

Timeline for d4mbzc_: