Lineage for d2mev1_ (2mev 1:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966284Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 966285Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 966332Protein Mengo encephalomyocarditis virus coat proteins [49678] (1 species)
  7. 966333Species Mengovirus [TaxId:12107] [49679] (2 PDB entries)
  8. 966335Domain d2mev1_: 2mev 1: [23558]
    complexed with po4

Details for d2mev1_

PDB Entry: 2mev (more details), 3 Å

PDB Description: structural refinement and analysis of mengo virus
PDB Compounds: (1:) mengo virus coat protein (subunit vp1)

SCOPe Domain Sequences for d2mev1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mev1_ b.121.4.1 (1:) Mengo encephalomyocarditis virus coat proteins {Mengovirus [TaxId: 12107]}
gvenaekgvtentdatadfvaqpvylpenqtkvaffydrsspigafavksgslesgfapf
snkacpnsviltpgpqfdpaydqlrpqrlteiwgngneetsevfplktkqdysfclfspf
vyykcdlevtlsphtsgahgllvrwcptgtptkpttqvlhevsslsegrtpqvysagpgt
snqisfvvpynsplsvlpavwynghkrfdntgdlgiapnsdfgtlffagtkpdikftvyl
ryknmrvfcprptvffpwptsgdkidmt

SCOPe Domain Coordinates for d2mev1_:

Click to download the PDB-style file with coordinates for d2mev1_.
(The format of our PDB-style files is described here.)

Timeline for d2mev1_: