SCOPe 2.04: Domain d4ldtc_: 4ldt C:

Lineage for d4ldtc_ (4ldt C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)

8. Domain d4ldtc_: 4ldt C: [235347]
   Other proteins in same PDB: d4ldtb_, d4ldtd_
   automated match to d3a33a_
   complexed with edo, mg

Details for d4ldtc_

PDB Entry: 4ldt, 1.9 Å

PDB Description: the structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub

PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4ldtc_:

Sequence; same for both SEQRES and ATOM records:

>d4ldtc_ d.20.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptd
ypfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddpl
vpeiariyktdrekynriarewtqkyam

Timeline for d4ldtc_:

• d4ldtc_ first appeared in SCOPe 2.03
  
• d4ldtc_ appears in SCOPe 2.05
  
• d4ldtc_ appears in the current release, SCOPe 2.08, called d4ldtc1