SCOPe 2.07: Domain d4ldtc1: 4ldt C:1-147

Lineage for d4ldtc1 (4ldt C:1-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d4ldtc1: 4ldt C:1-147 [235347]
   Other proteins in same PDB: d4ldtb_, d4ldtc2, d4ldtd_
   automated match to d3a33a_
   complexed with edo, mg

Details for d4ldtc1

PDB Entry: 4ldt, 1.9 Å

PDB Description: the structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub

PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4ldtc1:

Sequence; same for both SEQRES and ATOM records:

>d4ldtc1 d.20.1.1 (C:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d4ldtc1:

• d4ldtc1 first appeared in SCOPe 2.03, called d4ldtc_
  
• d4ldtc1 appears in SCOPe 2.06