Lineage for d4kola_ (4kol A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047898Domain d4kola_: 4kol A: [235200]
    Other proteins in same PDB: d4kolb_
    automated match to d4kona_
    complexed with nag

Details for d4kola_

PDB Entry: 4kol (more details), 2.8 Å

PDB Description: the structure of hemagglutinin from avian-origin h7n9 influenza virus
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4kola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kola_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe

SCOPe Domain Coordinates for d4kola_:

Click to download the PDB-style file with coordinates for d4kola_.
(The format of our PDB-style files is described here.)

Timeline for d4kola_: