Lineage for d4keuc_ (4keu C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2096705Protein automated matches [190150] (26 species)
    not a true protein
  7. 2096857Species Sulfolobus solfataricus [TaxId:2287] [188418] (12 PDB entries)
  8. 2096880Domain d4keuc_: 4keu C: [235151]
    automated match to d4keud_
    complexed with co, edo, fe2, gol

Details for d4keuc_

PDB Entry: 4keu (more details), 2.2 Å

PDB Description: Crystal structure of SsoPox W263M
PDB Compounds: (C:) aryldialkylphosphatase

SCOPe Domain Sequences for d4keuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4keuc_ c.1.9.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidmgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

SCOPe Domain Coordinates for d4keuc_:

Click to download the PDB-style file with coordinates for d4keuc_.
(The format of our PDB-style files is described here.)

Timeline for d4keuc_: