Lineage for d4i7ub1 (4i7u B:1-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836004Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries)
  8. 2836012Domain d4i7ub1: 4i7u B:1-294 [234831]
    Other proteins in same PDB: d4i7ub2, d4i7uc2, d4i7ud2
    automated match to d4i7ua_
    complexed with gol

Details for d4i7ub1

PDB Entry: 4i7u (more details), 1.55 Å

PDB Description: Dihydrodipicolinate Synthase of Agrobacterium tumefaciens
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4i7ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7ub1 c.1.10.0 (B:1-294) automated matches {Agrobacterium sp. [TaxId: 861208]}
mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv
elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs
avaeavklpiviynipprsvvdmspetmgalvkahknivgvkdatgkldrvseqriscgk
dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl
hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglmn

SCOPe Domain Coordinates for d4i7ub1:

Click to download the PDB-style file with coordinates for d4i7ub1.
(The format of our PDB-style files is described here.)

Timeline for d4i7ub1: