Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries) |
Domain d4i7ub1: 4i7u B:1-294 [234831] Other proteins in same PDB: d4i7ub2, d4i7uc2, d4i7ud2 automated match to d4i7ua_ complexed with gol |
PDB Entry: 4i7u (more details), 1.55 Å
SCOPe Domain Sequences for d4i7ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7ub1 c.1.10.0 (B:1-294) automated matches {Agrobacterium sp. [TaxId: 861208]} mfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgesptlshdehkrvv elcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkptqkglfahfs avaeavklpiviynipprsvvdmspetmgalvkahknivgvkdatgkldrvseqriscgk dfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyakaleyqdrlmpl hraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkhaglmn
Timeline for d4i7ub1: