Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries) |
Domain d4i55a2: 4i55 A:246-450 [234808] Other proteins in same PDB: d4i55a1, d4i55b1, d4i55c1, d4i55d1, d4i55e_ automated match to d4i4ta2 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 4i55 (more details), 2.2 Å
SCOPe Domain Sequences for d4i55a2:
Sequence, based on SEQRES records: (download)
>d4i55a2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsvegegeeegee
>d4i55a2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsvee
Timeline for d4i55a2: