SCOPe 2.08: Domain d4i55a2: 4i55 A:246-450

Lineage for d4i55a2 (4i55 A:246-450)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d4i55a2: 4i55 A:246-450 [234808]
   Other proteins in same PDB: d4i55a1, d4i55b1, d4i55c1, d4i55d1, d4i55e_, d4i55f1, d4i55f2, d4i55f3
   automated match to d4i4ta2
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4i55a2

PDB Entry: 4i55, 2.2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4i55a2:

Sequence, based on SEQRES records:

>d4i55a2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsvegegeeegee

Sequence, based on observed residues (ATOM records):

>d4i55a2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsvee

Timeline for d4i55a2:

• d4i55a2 first appeared in SCOPe 2.03
  
• d4i55a2 appears in SCOPe 2.07