Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
Protein automated matches [227930] (6 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [227937] (6 PDB entries) |
Domain d4hwoa2: 4hwo A:533-642 [234714] Other proteins in same PDB: d4hwoa1, d4hwoa3, d4hwob1 automated match to d4hwpb2 protein/RNA complex; complexed with 409, zn |
PDB Entry: 4hwo (more details), 1.91 Å
SCOPe Domain Sequences for d4hwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwoa2 c.51.1.0 (A:533-642) automated matches {Escherichia coli K-12 [TaxId: 83333]} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d4hwoa2: