SCOPe 2.03: Domain d4ggta_: 4ggt A:

Lineage for d4ggta_ (4ggt A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (7 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)

8. Domain d4ggta_: 4ggt A: [234470]
   automated match to d4jnja_

Details for d4ggta_

PDB Entry: 4ggt, 1.69 Å

PDB Description: Structure of apo Bradavidin2 (Form B)

PDB Compounds: (A:) Bradavidin 2

SCOPe Domain Sequences for d4ggta_:

Sequence, based on SEQRES records:

>d4ggta_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

Sequence, based on observed residues (ATOM records):

>d4ggta_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvnkgkpsrlkggdiftrvw

Timeline for d4ggta_:

• d4ggta_ is new in SCOPe 2.03-stable
  
• d4ggta_ appears in SCOPe 2.04
  
• d4ggta_ appears in the current release, SCOPe 2.08