Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d4g59b_: 4g59 B: [234446] automated match to d1kcgc_ complexed with nag |
PDB Entry: 4g59 (more details), 2.44 Å
SCOPe Domain Sequences for d4g59b_:
Sequence, based on SEQRES records: (download)
>d4g59b_ d.19.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ahslrcnltikaptpadplwyeakclvdeililhlsninktmtsgdpgetanatevgecl tqpvndlcqklrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfft fytenmswrsandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske
>d4g59b_ d.19.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ahslrcnltikaptpadplwyeakclvdeililhlsninktanatevgecltqpvndlcq klrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfftfytenmswr sandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske
Timeline for d4g59b_: