Lineage for d4g59b_ (4g59 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1406890Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1406891Protein automated matches [226842] (3 species)
    not a true protein
  7. 1406914Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries)
  8. 1406926Domain d4g59b_: 4g59 B: [234446]
    automated match to d1kcgc_
    complexed with nag

Details for d4g59b_

PDB Entry: 4g59 (more details), 2.44 Å

PDB Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m152 with ligand RAE-1 gamma
PDB Compounds: (B:) Retinoic acid early-inducible protein 1-gamma

SCOPe Domain Sequences for d4g59b_:

Sequence, based on SEQRES records: (download)

>d4g59b_ d.19.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ahslrcnltikaptpadplwyeakclvdeililhlsninktmtsgdpgetanatevgecl
tqpvndlcqklrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfft
fytenmswrsandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske

Sequence, based on observed residues (ATOM records): (download)

>d4g59b_ d.19.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ahslrcnltikaptpadplwyeakclvdeililhlsninktanatevgecltqpvndlcq
klrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfftfytenmswr
sandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske

SCOPe Domain Coordinates for d4g59b_:

Click to download the PDB-style file with coordinates for d4g59b_.
(The format of our PDB-style files is described here.)

Timeline for d4g59b_: