Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (14 species) not a true protein |
Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries) |
Domain d4fdqa_: 4fdq A: [234421] automated match to d4fcna_ complexed with ca, gol, hem, so4; mutant |
PDB Entry: 4fdq (more details), 1.6 Å
SCOPe Domain Sequences for d4fdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fdqa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]} atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl sdveqacaatpfpal
Timeline for d4fdqa_: