Lineage for d4fcna_ (4fcn A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333942Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2333949Domain d4fcna_: 4fcn A: [221147]
    automated match to d3q3ua_
    complexed with ca, hem, so4; mutant

Details for d4fcna_

PDB Entry: 4fcn (more details), 1.7 Å

PDB Description: The crystal structures of several mutants of pleurotus eryngii versatile peroxidase
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d4fcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fcna_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadgvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadp

SCOPe Domain Coordinates for d4fcna_:

Click to download the PDB-style file with coordinates for d4fcna_.
(The format of our PDB-style files is described here.)

Timeline for d4fcna_: