Lineage for d4ed5a2 (4ed5 A:100-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195684Domain d4ed5a2: 4ed5 A:100-185 [234388]
    automated match to d1fxla2
    protein/RNA complex; complexed with edo, gol, m2m

Details for d4ed5a2

PDB Entry: 4ed5 (more details), 2 Å

PDB Description: Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d4ed5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ed5a2 d.58.7.0 (A:100-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevikdanlyisglprtmtqkdvedmfsrfgriinsrvlvdqttglsrgvafirfdkrse
aeeaitsfnghkppgssepitvkfaa

SCOPe Domain Coordinates for d4ed5a2:

Click to download the PDB-style file with coordinates for d4ed5a2.
(The format of our PDB-style files is described here.)

Timeline for d4ed5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ed5a1