SCOPe 2.04: Domain d4ed5b2: 4ed5 B:100-186

Lineage for d4ed5b2 (4ed5 B:100-186)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)

8. Domain d4ed5b2: 4ed5 B:100-186 [234387]
   automated match to d1fxla2
   protein/RNA complex; complexed with edo, gol, m2m

Details for d4ed5b2

PDB Entry: 4ed5, 2 Å

PDB Description: Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA

PDB Compounds: (B:) ELAV-like protein 1

SCOPe Domain Sequences for d4ed5b2:

Sequence; same for both SEQRES and ATOM records:

>d4ed5b2 d.58.7.0 (B:100-186) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevikdanlyisglprtmtqkdvedmfsrfgriinsrvlvdqttglsrgvafirfdkrse
aeeaitsfnghkppgssepitvkfaan

Timeline for d4ed5b2:

• d4ed5b2 first appeared in SCOPe 2.03
  
• d4ed5b2 appears in SCOPe 2.05
  
• d4ed5b2 appears in the current release, SCOPe 2.08