Lineage for d4dr8a_ (4dr8 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442275Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1442276Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1442415Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 1442416Protein automated matches [191055] (9 species)
    not a true protein
  7. 1442445Species Synechococcus elongatus [TaxId:269084] [226557] (2 PDB entries)
  8. 1442446Domain d4dr8a_: 4dr8 A: [234331]
    automated match to d4dr8b_
    complexed with cl, edo, fmt, zn

Details for d4dr8a_

PDB Entry: 4dr8 (more details), 1.55 Å

PDB Description: Crystal structure of a peptide deformylase from Synechococcus elongatus
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d4dr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dr8a_ d.167.1.0 (A:) automated matches {Synechococcus elongatus [TaxId: 269084]}
taavairvakkklakppldlhylgdrvlrqpakrvsriddelrqtirqmlqtmysadgig
laapqvginkqlividleledeqapplvlinpkiertagdleqcqegclsipgvyldver
peivevsykdengrpqrlvadgllarciqhemdhlngvlfvdrvenrlelnealdkkgfa
vqavrpva

SCOPe Domain Coordinates for d4dr8a_:

Click to download the PDB-style file with coordinates for d4dr8a_.
(The format of our PDB-style files is described here.)

Timeline for d4dr8a_: