Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
Protein automated matches [191055] (9 species) not a true protein |
Species Synechococcus elongatus [TaxId:269084] [226557] (2 PDB entries) |
Domain d4dr8b_: 4dr8 B: [219962] automated match to d1veza_ complexed with cl, edo, fmt, zn |
PDB Entry: 4dr8 (more details), 1.55 Å
SCOPe Domain Sequences for d4dr8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dr8b_ d.167.1.0 (B:) automated matches {Synechococcus elongatus [TaxId: 269084]} avairvakkklakppldlhylgdrvlrqpakrvsriddelrqtirqmlqtmysadgigla apqvginkqlividleledeqapplvlinpkiertagdleqcqegclsipgvyldverpe ivevsykdengrpqrlvadgllarciqhemdhlngvlfvdrvenrlelnealdkkgfavq avrpvaa
Timeline for d4dr8b_: