SCOPe 2.08: Domain d4brwa1: 4brw A:46-250

Lineage for d4brwa1 (4brw A:46-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (6 PDB entries)

8. Domain d4brwa1: 4brw A:46-250 [234276]
   automated match to d2j0sa1
   complexed with 1pe, mpd

Details for d4brwa1

PDB Entry: 4brw, 2.8 Å

PDB Description: Crystal structure of the yeast Dhh1-Pat1 complex

PDB Compounds: (A:) ATP-dependent RNA helicase dhh1

SCOPe Domain Sequences for d4brwa1:

Sequence; same for both SEQRES and ATOM records:

>d4brwa1 c.37.1.0 (A:46-250) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ntfedfylkrellmgifeagfekpspiqeeaipvaitgrdilarakngtgktaafviptl
ekvkpklnkiqalimvptrelalqtsqvvrtlgkhcgiscmvttggtnlrddilrlnetv
hilvgtpgrvldlasrkvadlsdcslfimdeadkmlsrdfktiieqilsflppthqsllf
satfpltvdefmdkhlhkpyeinlm

Timeline for d4brwa1:

• d4brwa1 first appeared in SCOPe 2.03
  
• d4brwa1 appears in SCOPe 2.07