Lineage for d4bo9c_ (4bo9 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831871Species Pseudomonas aeruginosa [TaxId:208964] [196452] (24 PDB entries)
  8. 1831960Domain d4bo9c_: 4bo9 C: [234268]
    automated match to d4afnd_
    complexed with 3x3

Details for d4bo9c_

PDB Entry: 4bo9 (more details), 2.9 Å

PDB Description: Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (FabG) from Pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9A resolution
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bo9c_:

Sequence, based on SEQRES records: (download)

>d4bo9c_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bo9c_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnadewfdvvntnlnslyrlskavlrgmtkarw
griinigsvnagqtnyaaakaglegftralarevgsraitvnavapgfidtdmtrelpea
qreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmyms

SCOPe Domain Coordinates for d4bo9c_:

Click to download the PDB-style file with coordinates for d4bo9c_.
(The format of our PDB-style files is described here.)

Timeline for d4bo9c_: