Lineage for d4bntc1 (4bnt C:1-247)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456436Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (29 PDB entries)
  8. 2456480Domain d4bntc1: 4bnt C:1-247 [234211]
    Other proteins in same PDB: d4bnta2, d4bntb2, d4bntc2, d4bntd2
    automated match to d4afna_
    complexed with 36e

Details for d4bntc1

PDB Entry: 4bnt (more details), 2.3 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-(trifluoromethyl)-1h- benzimidazole at 2.3a resolution
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bntc1:

Sequence, based on SEQRES records: (download)

>d4bntc1 c.2.1.0 (C:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bntc1 c.2.1.0 (C:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnadewfdvvntnlnslyrlskavlrgmtkarw
griinigsvvnagqtnyaaakaglegftralarevgsraitvnavapgfidtdmtrelpe
aqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmyms

SCOPe Domain Coordinates for d4bntc1:

Click to download the PDB-style file with coordinates for d4bntc1.
(The format of our PDB-style files is described here.)

Timeline for d4bntc1: