Lineage for d4bntc_ (4bnt C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350904Species Pseudomonas aeruginosa [TaxId:208964] [196452] (24 PDB entries)
  8. 1350949Domain d4bntc_: 4bnt C: [234211]
    automated match to d4afna_
    complexed with 36e

Details for d4bntc_

PDB Entry: 4bnt (more details), 2.3 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-(trifluoromethyl)-1h- benzimidazole at 2.3a resolution
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bntc_:

Sequence, based on SEQRES records: (download)

>d4bntc_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangve
gaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnln
slyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsr
aitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtg
atvpvnggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bntc_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangve
gaglvldvssdesvaatlehiqqhlgqplivvnnadewfdvvntnlnslyrlskavlrgm
tkarwgriinigsvvnagqtnyaaakaglegftralarevgsraitvnavapgfidtdmt
relpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmyms

SCOPe Domain Coordinates for d4bntc_:

Click to download the PDB-style file with coordinates for d4bntc_.
(The format of our PDB-style files is described here.)

Timeline for d4bntc_: