Lineage for d4baea_ (4bae A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213664Species Mycobacterium smegmatis [TaxId:1772] [228578] (2 PDB entries)
  8. 2213667Domain d4baea_: 4bae A: [234131]
    automated match to d4baed_
    complexed with ca, rwx, so4

Details for d4baea_

PDB Entry: 4bae (more details), 2.35 Å

PDB Description: optimisation of pyrroleamides as mycobacterial gyrb atpase inhibitors: structure activity relationship and in vivo efficacy in the mouse model of tuberculosis
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4baea_:

Sequence, based on SEQRES records: (download)

>d4baea_ d.122.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrleatvlr
dgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlqemafln
kgltieltderdgkhrvfhyp

Sequence, based on observed residues (ATOM records): (download)

>d4baea_ d.122.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlhgvgvsvvnalstrleatvlrdgyewfqyydrsvpgkl
kqggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgkhrv
fhyp

SCOPe Domain Coordinates for d4baea_:

Click to download the PDB-style file with coordinates for d4baea_.
(The format of our PDB-style files is described here.)

Timeline for d4baea_: