SCOPe 2.05: Domain d3wg2b_: 3wg2 B:

Lineage for d3wg2b_ (3wg2 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d3wg2b_: 3wg2 B: [233957]
   automated match to d3wg4a_
   complexed with pge; mutant

Details for d3wg2b_

PDB Entry: 3wg2, 2.2 Å

PDB Description: crystal structure of agrocybe cylindracea galectin mutant (n46a)

PDB Compounds: (B:) Galactoside-binding lectin

SCOPe Domain Sequences for d3wg2b_:

Sequence, based on SEQRES records:

>d3wg2b_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
tsavniynisagasvdlaapvttgdivtffssalnlsagagspantalnllsengayllh
iafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinekt
viqytkqisgttsslsynstegtsifstvveavtytgla

Sequence, based on observed residues (ATOM records):

>d3wg2b_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
tsavniynisagasvdlaapvttgdivtffssalnlsntalnllsengayllhiafrlqe
nvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviqytkq
isgttsslsynstegtsifstvveavtytgla

Timeline for d3wg2b_:

• d3wg2b_ first appeared in SCOPe 2.03
  
• d3wg2b_ appears in SCOPe 2.04
  
• d3wg2b_ is called d3wg2b1 in SCOPe 2.06
  
• d3wg2b_ appears in the current release, SCOPe 2.08, called d3wg2b1