SCOPe 2.03: Domain d3ppeb2: 3ppe B:98-203

Lineage for d3ppeb2 (3ppe B:98-203)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)

8. Domain d3ppeb2: 3ppe B:98-203 [233264]
   automated match to d3lnda2
   complexed with ca

Details for d3ppeb2

PDB Entry: 3ppe, 2.1 Å

PDB Description: Crystal structure of chicken VE-cadherin EC1-2

PDB Compounds: (B:) Vascular endothelial cadherin

SCOPe Domain Sequences for d3ppeb2:

Sequence; same for both SEQRES and ATOM records:

>d3ppeb2 b.1.6.0 (B:98-203) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ndnapifvqkifngsvpemsrlgtsvtkvtaedaddptvaghatvtyqiikgneyftvdd
sgviftaradldresqsayeiivkakdalgltgesstatviirltd

Timeline for d3ppeb2:

• d3ppeb2 is new in SCOPe 2.03-stable
  
• d3ppeb2 appears in SCOPe 2.04
  
• d3ppeb2 appears in the current release, SCOPe 2.08