SCOP 1.63: Domain d1ddlc_: 1ddl C:

Lineage for d1ddlc_ (1ddl C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (18 proteins)

6. Protein DYMV coat protein [49643] (1 species)

7. Species Desmodium yellow mottle tymovirus [TaxId:70821] [49644] (1 PDB entry)

8. Domain d1ddlc_: 1ddl C: [23319]

Details for d1ddlc_

PDB Entry: 1ddl, 2.7 Å

PDB Description: desmodium yellow mottle tymovirus

SCOP Domain Sequences for d1ddlc_:

Sequence; same for both SEQRES and ATOM records:

>d1ddlc_ b.10.1.2 (C:) DYMV coat protein {Desmodium yellow mottle tymovirus}
ntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvlatytalyrhaqlkh
lkatihptymapkyptsvalvwvpanstatstqvldtygglhfciggsvnsvkpidvean
ltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqielsspllqass

Timeline for d1ddlc_:

• d1ddlc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ddlc_ appears in SCOP 1.61
  
• d1ddlc_ appears in SCOP 1.65
  
• d1ddlc_ appears in the current release, SCOPe 2.08