Class b: All beta proteins [48724] (119 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (18 proteins) |
Protein DYMV coat protein [49643] (1 species) |
Species Desmodium yellow mottle tymovirus [TaxId:70821] [49644] (1 PDB entry) |
Domain d1ddla_: 1ddl A: [23317] |
PDB Entry: 1ddl (more details), 2.7 Å
SCOP Domain Sequences for d1ddla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddla_ b.10.1.2 (A:) DYMV coat protein {Desmodium yellow mottle tymovirus} meqdkilahqaslntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvla tytalyrhaqlkhlkatihptymapkyptsvalvwvpanstatstqvldtygglhfcigg svnsvkpidveanltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqiels spllqass
Timeline for d1ddla_: