SCOPe 2.05: Domain d3mgea1: 3mge A:1-147

Lineage for d3mgea1 (3mge A:1-147)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [232915] (1 PDB entry)

8. Domain d3mgea1: 3mge A:1-147 [232916]
   Other proteins in same PDB: d3mgea2
   automated match to d1e6jp2
   complexed with edo

Details for d3mgea1

PDB Entry: 3mge, 1.9 Å

PDB Description: x-ray structure of hexameric hiv-1 ca

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3mgea1:

Sequence, based on SEQRES records:

>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
pivmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvgghqaam
qmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

Timeline for d3mgea1:

• d3mgea1 first appeared in SCOPe 2.03
  
• d3mgea1 appears in SCOPe 2.04
  
• d3mgea1 appears in SCOPe 2.06
  
• d3mgea1 appears in the current release, SCOPe 2.08