SCOPe 2.06: Domain d3m63b_: 3m63 B:

Lineage for d3m63b_ (3m63 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (7 PDB entries)

8. Domain d3m63b_: 3m63 B: [232888]
   automated match to d3v6eb_
   complexed with 1pe, k

Details for d3m63b_

PDB Entry: 3m63, 2.4 Å

PDB Description: crystal structure of ufd2 in complex with the ubiquitin-like (ubl) domain of dsk2

PDB Compounds: (B:) Ubiquitin domain-containing protein DSK2

SCOPe Domain Sequences for d3m63b_:

Sequence; same for both SEQRES and ATOM records:

>d3m63b_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

Timeline for d3m63b_:

• d3m63b_ first appeared in SCOPe 2.03
  
• d3m63b_ appears in SCOPe 2.05
  
• d3m63b_ appears in SCOPe 2.07
  
• d3m63b_ appears in the current release, SCOPe 2.08