SCOPe 2.03: Domain d3liea2: 3lie A:207-302

Lineage for d3liea2 (3lie A:207-302)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (3 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins)
   PfamB PB021678

6. Protein GGDEF family protein VP0354 [160677] (1 species)
   N-terminal region, consist of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region

7. Species Vibrio parahaemolyticus [TaxId:670] [160678] (3 PDB entries)
   Uniprot Q87SR8 207-299! Uniprot Q87SR8 35-206

8. Domain d3liea2: 3lie A:207-302 [232844]
   automated match to d2p7jb1
   complexed with mg

Details for d3liea2

PDB Entry: 3lie, 2.59 Å

PDB Description: crystal structure of the extracellular domain of the putative histidine kinase vphk1s-z8

PDB Compounds: (A:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d3liea2:

Sequence; same for both SEQRES and ATOM records:

>d3liea2 d.110.6.2 (A:207-302) GGDEF family protein VP0354 {Vibrio parahaemolyticus [TaxId: 670]}
nyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagys
ysgehliafssikfvsneplhliidlsneqlskrat

Timeline for d3liea2:

• d3liea2 is new in SCOPe 2.03-stable
  
• d3liea2 appears in SCOPe 2.04
  
• d3liea2 appears in the current release, SCOPe 2.08