Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) zinc-binding motif |
Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) automatically mapped to Pfam PF01085 |
Protein automated matches [190324] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188953] (15 PDB entries) |
Domain d3k7jb_: 3k7j B: [232678] automated match to d1vhha_ complexed with co3, so4, zn; mutant |
PDB Entry: 3k7j (more details), 1.9 Å
SCOPe Domain Sequences for d3k7jb_:
Sequence, based on SEQRES records: (download)
>d3k7jb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgae rlmtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdr nkygllarlaveagfdwvyyeskahvhcsvks
>d3k7jb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkaerlmtqr ckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnkygll arlaveagfdwvyyeskahvhcsvks
Timeline for d3k7jb_: